PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK05478.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 615aa    MW: 67916.1 Da    PI: 6.1294
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK05478.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS327.13.3e-1002536153374
       GRAS   3 elLlecAeavssgdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                + ++e+A a+s+g++e a+++L+rls++ ++p+ ++ qR+  ++  AL++r+        +  +p + +e  s+e+ +a + ++++sP++ +s+ +aN a
  PK05478.1 253 QSVMEAALAISDGKTESANEILTRLSTQvSNPRPTSEQRVLEFISSALKSRIKP------EE-NPPPVTELYSQEQGSAIQSLYDLSPCFGLSFSAANFA 345
                7799**********************99556666*******************9......33.33444445699999*********************** PP

       GRAS 102 Ileavege..ervHiiDfdisqGlQWpaLlqaLasRpeg.ppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                Il+a+ ++   ++H+iDfdi++G+Q++ Ll++La R++g   sl+iT++++ + + +e+l+++ e+L+++A++lgv fe +v  + r+++l+ e+L ++p
  PK05478.1 346 ILDATLTDdsAKIHVIDFDIGYGGQYVDLLRKLAGRKNGiLSSLKITTLAD-NVVTQERLKSVDEKLSQLARSLGVVFELTV-KSLRISELSRESLGCEP 443
                ****87765699**********************99977256*********.5579*************************9.899************** PP

       GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                +E++aVn++++l+ ++desvs+e++rd++L+ vks+ P+vv+vveqe+++n+++F++r+ e++ yys+l+ds++   +r+++er+ vE++ ++r++ n v
  PK05478.1 444 DESIAVNFAFKLYMMPDESVSTENPRDQLLRRVKSMAPRVVTVVEQELNTNTAPFMARVNETCAYYSVLLDSVDPAGSRDNSERVRVEEA-VSRKVGNSV 542
                *************************************************************************9999*************.9******** PP

       GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                aceg++r+er+e ++kWr+rl++aGF+++pls++a +  ++  r +     +v+ee++ +++gW++r+L+++SaWr
  PK05478.1 543 ACEGRDRFERCEVFGKWRARLSMAGFESIPLSQDAKTRLSSGNRFH---NLSVKEENQGICFGWMGRTLTVASAWR 615
                *********************************9988776654444...489***********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.303225598IPR005202Transcription factor GRAS
PfamPF035141.2E-97253615IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 615 aa     Download sequence    Send to blast
MQSGYTGAGG LPDFYTTGRS TMNNVPSQPP YHRPQLPGLF IDSTTQRIAR QNPTTLIGKR  60
NLAEFQSNHH NQQQQQYNPN LGLVQPNYLR SVKPRTFQQS SPISPLSPME FSPTATTVSE  120
SSSCSSSSPA SSQRYGLPLP QQQYLRPQQP NIQGMSYVNP VQQNRVIPVV DSEKKIMNTR  180
LQELEKQLLD DNEDEEGDPV SAITNNSEWS ETIQNLISPN QTQKPVSPSP TSSSSSSSSS  240
SVASPAILTF SKQSVMEAAL AISDGKTESA NEILTRLSTQ VSNPRPTSEQ RVLEFISSAL  300
KSRIKPEENP PPVTELYSQE QGSAIQSLYD LSPCFGLSFS AANFAILDAT LTDDSAKIHV  360
IDFDIGYGGQ YVDLLRKLAG RKNGILSSLK ITTLADNVVT QERLKSVDEK LSQLARSLGV  420
VFELTVKSLR ISELSRESLG CEPDESIAVN FAFKLYMMPD ESVSTENPRD QLLRRVKSMA  480
PRVVTVVEQE LNTNTAPFMA RVNETCAYYS VLLDSVDPAG SRDNSERVRV EEAVSRKVGN  540
SVACEGRDRF ERCEVFGKWR ARLSMAGFES IPLSQDAKTR LSSGNRFHNL SVKEENQGIC  600
FGWMGRTLTV ASAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-4029061541375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010096860.10.0hypothetical protein L484_003031
SwissprotQ9FYR71e-167SCL8_ARATH; Scarecrow-like protein 8
TrEMBLW9RDH00.0W9RDH0_9R
STRINGVIT_16s0050g00950.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62663151
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.11e-144SCARECROW-like 8